PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G20530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 317aa    MW: 33141.3 Da    PI: 8.3034
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G20530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171664148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEde+lv +v q+Gg+ +W++ +++ g++R+ k+c++rw +yl
  ORUFI03G20530.1 16 KGPWTREEDEKLVAYVDQHGGHgSWRSLPKRAGLNRCCKSCRLRWINYL 64
                     79*******************9*************************97 PP

2Myb_DNA-binding54.52.7e-1770113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++ ++ ++  lG++ W+tIa +++ gRt++++k++w++
  ORUFI03G20530.1  70 RGNFTPEEEQAIITLHSVLGNK-WSTIATRLP-GRTDNEIKNYWNT 113
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2961164IPR017930Myb domain
SuperFamilySSF466892.25E-2913111IPR009057Homeodomain-like
SMARTSM007171.3E-131566IPR001005SANT/Myb domain
PfamPF002491.0E-141664IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-241771IPR009057Homeodomain-like
CDDcd001671.06E-101864No hitNo description
PROSITE profilePS5129426.74265119IPR017930Myb domain
SMARTSM007174.3E-1669117IPR001005SANT/Myb domain
PfamPF002492.5E-1570113IPR001005SANT/Myb domain
CDDcd001673.29E-1272115No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2772119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGRLRPPCCD ESSVKKGPWT REEDEKLVAY VDQHGGHGSW RSLPKRAGLN RCCKSCRLRW  60
INYLRPDIKR GNFTPEEEQA IITLHSVLGN KWSTIATRLP GRTDNEIKNY WNTRLKKRLI  120
GAGIDPATHR ARPRPPAPGD LATALPQLVA LASLAVDLAV GHAAAAGGAW GAANGAVDYQ  180
QADAAAAQLQ CLQHLLLQPQ TTPATSATSG GGGHPTELNA ASSFLTQAVA SYAAAAATPL  240
PSLVVPGGSQ PLELKRWQDH IGGDHVGAVS PFAGAATVTG HHGGGGGGGG EFLPSELTAL  300
LCSANAIGDL QSSNLDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26161197108B-MYB
1gv2_A2e-26161194105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-26161194105C-Myb DNA-Binding Domain
1msf_C2e-26161194105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2434280.0AK243428.1 Oryza sativa Japonica Group cDNA, clone: J100067L15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631094.10.0PREDICTED: transcription factor MYB39
SwissprotQ9SZP11e-62MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0E0NVZ70.0A0A0E0NVZ7_ORYRU; Uncharacterized protein
STRINGLOC_Os03g27090.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP180181010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.26e-65myb domain protein 9